Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Mouse (Mus musculus) [TaxId:10090] [54457] (19 PDB entries) |
Domain d3scma1: 3scm A:7-185 [200606] Other proteins in same PDB: d3scma2, d3scmb_, d3scmc1, d3scmc2, d3scmd1, d3scmd2 automated match to d1gzpa2 complexed with lgn, nag |
PDB Entry: 3scm (more details), 2.5 Å
SCOPe Domain Sequences for d3scma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3scma1 d.19.1.1 (A:7-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3scma1: