SCOP 1.67: Domain d1a14l_: 1a14 L:

Lineage for d1a14l_ (1a14 L:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (160 PDB entries)

8. Domain d1a14l_: 1a14 L: [20060]
   Other proteins in same PDB: d1a14h_, d1a14n_
   part of Fab NC10; only Fv coordinates are included
   complexed with ca, man, nag

Details for d1a14l_

PDB Entry: 1a14, 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 5 residue linker and influenza virus neuraminidase

SCOP Domain Sequences for d1a14l_:

Sequence; same for both SEQRES and ATOM records:

>d1a14l_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
dieltqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtaa

Timeline for d1a14l_:

• d1a14l_ first appeared (with stable ids) in SCOP 1.55
  
• d1a14l_ appears in SCOP 1.65
  
• d1a14l_ appears in SCOP 1.69
  
• d1a14l_ appears in the current release, SCOPe 2.08