SCOPe 2.07: Domain d3s8gb1: 3s8g B:3-40

Lineage for d3s8gb1 (3s8g B:3-40)

1. Root: SCOPe 2.07

2. Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Bacterial ba3 type cytochrome c oxidase subunit II [81460] (1 species)

7. Species Thermus thermophilus [TaxId:274] [81459] (23 PDB entries)
   the "missing" first helix is complemented by the ba3 subunit IIa

8. Domain d3s8gb1: 3s8g B:3-40 [200598]
   Other proteins in same PDB: d3s8ga_, d3s8gb2, d3s8gc_
   automated match to d1ehkb2
   complexed with cu, cua, has, hem, olc, per; mutant

Details for d3s8gb1

PDB Entry: 3s8g, 1.8 Å

PDB Description: 1.8 a structure of ba3 cytochrome c oxidase mutant (a120f) from thermus thermophilus in lipid environment

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3s8gb1:

Sequence; same for both SEQRES and ATOM records:

>d3s8gb1 f.17.2.1 (B:3-40) Bacterial ba3 type cytochrome c oxidase subunit II {Thermus thermophilus [TaxId: 274]}
dehkahkailayekgwlafslamlfvfialiaytlath

Timeline for d3s8gb1:

• d3s8gb1 first appeared in SCOPe 2.03
  
• d3s8gb1 appears in SCOPe 2.06
  
• d3s8gb1 appears in the current release, SCOPe 2.08