SCOPe 2.07: Domain d3s8fb2: 3s8f B:41-168

Lineage for d3s8fb2 (3s8f B:41-168)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.1: Cupredoxins [49503] (8 families)
   contains copper-binding site

5. Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins)

6. Protein Cytochrome c oxidase [49544] (4 species)

7. Species Thermus thermophilus, ba3 type [TaxId:274] [49547] (37 PDB entries)

8. Domain d3s8fb2: 3s8f B:41-168 [200597]
   Other proteins in same PDB: d3s8fa_, d3s8fb1, d3s8fc_
   automated match to d1ehkb1
   complexed with cu, cua, has, hem, olc, per

Details for d3s8fb2

PDB Entry: 3s8f, 1.8 Å

PDB Description: 1.8 a structure of ba3 cytochrome c oxidase from thermus thermophilus in lipid environment

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d3s8fb2:

Sequence; same for both SEQRES and ATOM records:

>d3s8fb2 b.6.1.2 (B:41-168) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]}
tagvipagklervdpttvrqegpwadpaqavvqtgpnqytvyvlafafgyqpnpievpqg
aeivfkitspdvihgfhvegtninvevlpgevstvrytfkrpgeyriicnqycglghqnm
fgtivvke

Timeline for d3s8fb2:

• d3s8fb2 first appeared in SCOPe 2.03
  
• d3s8fb2 appears in SCOPe 2.06
  
• d3s8fb2 appears in the current release, SCOPe 2.08