SCOPe 2.08: Domain d3s7ra_: 3s7r A:

Lineage for d3s7ra_ (3s7r A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein automated matches [190332] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187155] (29 PDB entries)

8. Domain d3s7ra_: 3s7r A: [200592]
   automated match to d3s7rb_
   complexed with unl

Details for d3s7ra_

PDB Entry: 3s7r, 2.15 Å

PDB Description: crystal structure of a heterogeneous nuclear ribonucleoprotein a/b (hnrpab) from homo sapiens at 2.15 a resolution

PDB Compounds: (A:) Heterogeneous nuclear ribonucleoprotein A/B

SCOPe Domain Sequences for d3s7ra_:

Sequence; same for both SEQRES and ATOM records:

>d3s7ra_ d.58.7.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
needagkmfvgglswdtskkdlkdyftkfgevvdctikmdpntgrsrgfgfilfkdaasv
ekvldqkehrldgrvidpkka

Timeline for d3s7ra_:

• d3s7ra_ first appeared in SCOPe 2.03
  
• d3s7ra_ appears in SCOPe 2.07