Lineage for d3s6ng_ (3s6n G:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1539176Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 1539177Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 1539744Family b.38.1.0: automated matches [191538] (1 protein)
    not a true family
  6. 1539745Protein automated matches [190914] (8 species)
    not a true protein
  7. 1539807Species Human (Homo sapiens) [TaxId:9606] [196227] (4 PDB entries)
  8. 1539809Domain d3s6ng_: 3s6n G: [200591]
    Other proteins in same PDB: d3s6na_, d3s6nb_
    automated match to d3swne_
    protein/RNA complex

Details for d3s6ng_

PDB Entry: 3s6n (more details), 2.5 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1/d2/f/e/g from human
PDB Compounds: (G:) Small nuclear ribonucleoprotein G

SCOPe Domain Sequences for d3s6ng_:

Sequence, based on SEQRES records: (download)

>d3s6ng_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkklslklnggrhvqgilrgfdpfmnlvidecvematsgqqnnigmvvirgnsiimlea

Sequence, based on observed residues (ATOM records): (download)

>d3s6ng_ b.38.1.0 (G:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dkklslklnggrhvqgilrgfdpfmnlvidecvematsnigmvvirgnsiimlea

SCOPe Domain Coordinates for d3s6ng_:

Click to download the PDB-style file with coordinates for d3s6ng_.
(The format of our PDB-style files is described here.)

Timeline for d3s6ng_: