SCOPe 2.07: Domain d3s6na_: 3s6n A:

Lineage for d3s6na_ (3s6n A:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.38: Sm-like fold [50181] (5 superfamilies)
   core: barrel, open; n*=4, S*=8; meander; SH3-like topology

4. Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families)

5. Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (11 proteins)
   forms homo and heteroheptameric ring structures
   Pfam PF01423

6. Protein D1 core SNRNP protein [50184] (4 species)

7. Species Human (Homo sapiens) [TaxId:9606] [50185] (11 PDB entries)

8. Domain d3s6na_: 3s6n A: [200589]
   Other proteins in same PDB: d3s6nb_, d3s6ne_, d3s6nf_, d3s6ng_
   automated match to d1b34a_
   protein/RNA complex

Details for d3s6na_

PDB Entry: 3s6n, 2.5 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1/d2/f/e/g from human

PDB Compounds: (A:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d3s6na_:

Sequence; same for both SEQRES and ATOM records:

>d3s6na_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
rgnniryfilpdslpldtllv

Timeline for d3s6na_:

• d3s6na_ first appeared in SCOPe 2.03
  
• d3s6na_ appears in SCOPe 2.06
  
• d3s6na_ does not appear in SCOPe 2.08