Lineage for d3s6na_ (3s6n A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2057136Fold b.38: Sm-like fold [50181] (5 superfamilies)
    core: barrel, open; n*=4, S*=8; meander; SH3-like topology
  4. 2057137Superfamily b.38.1: Sm-like ribonucleoproteins [50182] (7 families) (S)
  5. 2057138Family b.38.1.1: Sm motif of small nuclear ribonucleoproteins, SNRNP [50183] (8 proteins)
    forms homo and heteroheptameric ring structures
  6. 2057316Protein D1 core SNRNP protein [50184] (2 species)
  7. 2057317Species Human (Homo sapiens) [TaxId:9606] [50185] (5 PDB entries)
  8. 2057319Domain d3s6na_: 3s6n A: [200589]
    Other proteins in same PDB: d3s6nb_, d3s6nf_, d3s6ng_
    automated match to d1b34a_
    protein/RNA complex

Details for d3s6na_

PDB Entry: 3s6n (more details), 2.5 Å

PDB Description: crystal structure of the gemin2-binding domain of smn, gemin2 in complex with smd1/d2/f/e/g from human
PDB Compounds: (A:) Small nuclear ribonucleoprotein Sm D1

SCOPe Domain Sequences for d3s6na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3s6na_ b.38.1.1 (A:) D1 core SNRNP protein {Human (Homo sapiens) [TaxId: 9606]}
mklvrflmklshetvtielkngtqvhgtitgvdvsmnthlkavkmtlknrepvqletlsi
rgnniryfilpdslpldtllv

SCOPe Domain Coordinates for d3s6na_:

Click to download the PDB-style file with coordinates for d3s6na_.
(The format of our PDB-style files is described here.)

Timeline for d3s6na_: