SCOP 1.69: Domain d1nmcb_: 1nmc B:

Lineage for d1nmcb_ (1nmc B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d1nmcb_: 1nmc B: [20058]
   Other proteins in same PDB: d1nmca_, d1nmcc_, d1nmcl_, d1nmcn_
   part of Fab NC10; only Fv coordinates are included

Details for d1nmcb_

PDB Entry: 1nmc, 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 15 residue linker and influenza virus neuraminidase

SCOP Domain Sequences for d1nmcb_:

Sequence; same for both SEQRES and ATOM records:

>d1nmcb_ b.1.1.1 (B:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
ss

Timeline for d1nmcb_:

• d1nmcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1nmcb_ appears in SCOP 1.67
  
• d1nmcb_ appears in SCOP 1.71
  
• d1nmcb_ appears in the current release, SCOPe 2.08, called d1nmcb1