SCOP 1.63: Domain d1nmcb_: 1nmc B:

Lineage for d1nmcb_ (1nmc B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)

7. Species Fab NC10 (mouse), kappa L chain [48804] (4 PDB entries)
   only Fv coordinates are included

8. Domain d1nmcb_: 1nmc B: [20058]
   Other proteins in same PDB: d1nmca_, d1nmcn_

Details for d1nmcb_

PDB Entry: 1nmc, 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 15 residue linker and influenza virus neuraminidase

SCOP Domain Sequences for d1nmcb_:

Sequence; same for both SEQRES and ATOM records:

>d1nmcb_ b.1.1.1 (B:) Immunoglobulin (variable domains of L and H chains) {Fab NC10 (mouse), kappa L chain}
qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
ss

Timeline for d1nmcb_:

• d1nmcb_ first appeared (with stable ids) in SCOP 1.55
  
• d1nmcb_ appears in SCOP 1.61
  
• d1nmcb_ appears in SCOP 1.65
  
• d1nmcb_ appears in the current release, SCOPe 2.08, called d1nmcb1