Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
Protein T-cell antigen receptor [48933] (6 species) sequences may differ within each classified species |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [48936] (28 PDB entries) |
Domain d3rzcd1: 3rzc D:2-112 [200573] Other proteins in same PDB: d3rzca1, d3rzca2, d3rzcb_, d3rzcc1, d3rzcc2, d3rzcd2 automated match to d1lp9f1 complexed with lgn |
PDB Entry: 3rzc (more details), 2.8 Å
SCOPe Domain Sequences for d3rzcd1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rzcd1 b.1.1.1 (D:2-112) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} aavtqsprnkvavtggkvtlscnqtnnhnnmywyrqdtghglrlihysygagstekgdip dgykasrpsqenfslilelatpsqtsvyfcasgdegytqyfgpgtrllvle
Timeline for d3rzcd1: