SCOPe 2.03: Domain d3rzcc2: 3rzc C:118-206

Lineage for d3rzcc2 (3rzc C:118-206)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein T-cell antigen receptor [49125] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [226194] (2 PDB entries)

8. Domain d3rzcc2: 3rzc C:118-206 [200572]
   Other proteins in same PDB: d3rzca1, d3rzca2, d3rzcb_, d3rzcc1, d3rzcd1, d3rzcd2
   automated match to d1qrnd2
   complexed with lgn

Details for d3rzcc2

PDB Entry: 3rzc, 2.8 Å

PDB Description: structure of the self-antigen igb3 bound to mouse cd1d and in complex with the inkt tcr

PDB Compounds: (C:) Valpha14

SCOPe Domain Sequences for d3rzcc2:

Sequence, based on SEQRES records:

>d3rzcc2 b.1.1.2 (C:118-206) T-cell antigen receptor {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records):

>d3rzcc2 b.1.1.2 (C:118-206) T-cell antigen receptor {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnkdfacanafnnsiipedtffps

Timeline for d3rzcc2:

• d3rzcc2 is new in SCOPe 2.03-stable
  
• d3rzcc2 appears in SCOPe 2.04
  
• d3rzcc2 appears in the current release, SCOPe 2.08