Lineage for d3rzcc1 (3rzc C:1-117)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2034475Species Mouse (Mus musculus) [TaxId:10090] [188198] (574 PDB entries)
  8. 2035009Domain d3rzcc1: 3rzc C:1-117 [200571]
    Other proteins in same PDB: d3rzca1, d3rzca2, d3rzcb_, d3rzcc2, d3rzcd1
    automated match to d1qrnd1
    complexed with lgn

Details for d3rzcc1

PDB Entry: 3rzc (more details), 2.8 Å

PDB Description: structure of the self-antigen igb3 bound to mouse cd1d and in complex with the inkt tcr
PDB Compounds: (C:) Valpha14

SCOPe Domain Sequences for d3rzcc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzcc1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgencvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

SCOPe Domain Coordinates for d3rzcc1:

Click to download the PDB-style file with coordinates for d3rzcc1.
(The format of our PDB-style files is described here.)

Timeline for d3rzcc1: