Lineage for d1nmch_ (1nmc H:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1287434Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1287435Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 1287638Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 1288122Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (177 PDB entries)
    Uniprot P01756 1-117 # 78% sequense identity; HV12_MOUSE Ig heavy chain V region MOPC 104E ! SQ NA # humanized antibody ! Uniprot P01750 # HV06_MOUSE Ig heavy chain V region 102 precursor ! Uniprot P01750 20-116 # ! HV06_MOUSE Ig heavy chain V region 102 precursor
  8. 1288250Domain d1nmch_: 1nmc H: [20057]
    Other proteins in same PDB: d1nmca_, d1nmcc_, d1nmcl_, d1nmcn_
    part of Fab NC10; only Fv coordinates are included
    complexed with ca, man, nag

Details for d1nmch_

PDB Entry: 1nmc (more details), 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 15 residue linker and influenza virus neuraminidase
PDB Compounds: (H:) single chain antibody

SCOPe Domain Sequences for d1nmch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmch_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
ss

SCOPe Domain Coordinates for d1nmch_:

Click to download the PDB-style file with coordinates for d1nmch_.
(The format of our PDB-style files is described here.)

Timeline for d1nmch_: