SCOP 1.65: Domain d1nmch_: 1nmc H:

Lineage for d1nmch_ (1nmc H:)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (19 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (118 PDB entries)

8. Domain d1nmch_: 1nmc H: [20057]
   Other proteins in same PDB: d1nmca_, d1nmcc_, d1nmcl_, d1nmcn_

Details for d1nmch_

PDB Entry: 1nmc, 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 15 residue linker and influenza virus neuraminidase

SCOP Domain Sequences for d1nmch_:

Sequence; same for both SEQRES and ATOM records:

>d1nmch_ b.1.1.1 (H:) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
ss

Timeline for d1nmch_:

• d1nmch_ first appeared (with stable ids) in SCOP 1.55
  
• d1nmch_ appears in SCOP 1.63
  
• d1nmch_ appears in SCOP 1.67
  
• d1nmch_ appears in the current release, SCOPe 2.08, called d1nmch1