Lineage for d1nmch_ (1nmc H:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 101939Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)
  6. 101995Protein Immunoglobulin (variable domains of L and H chains) [48749] (205 species)
  7. 102830Species Fab NC10 (mouse), kappa L chain [48804] (4 PDB entries)
  8. 102835Domain d1nmch_: 1nmc H: [20057]
    Other proteins in same PDB: d1nmca_, d1nmcn_

Details for d1nmch_

PDB Entry: 1nmc (more details), 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 15 residue linker and influenza virus neuraminidase

SCOP Domain Sequences for d1nmch_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nmch_ b.1.1.1 (H:) Immunoglobulin (variable domains of L and H chains) {Fab NC10 (mouse), kappa L chain}
qvqlqqsgaelvkpgasvrmsckasgytftnynmywvkqspgqglewigifypgngdtsy
nqkfkdkatltadkssntaymqlssltsedsavyycarsggsyrydggfdywgqgttvtv
ss

SCOP Domain Coordinates for d1nmch_:

Click to download the PDB-style file with coordinates for d1nmch_.
(The format of our PDB-style files is described here.)

Timeline for d1nmch_: