Lineage for d3rzca1 (3rzc A:6-185)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1405985Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 1405986Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 1406890Family d.19.1.0: automated matches [227140] (1 protein)
    not a true family
  6. 1406891Protein automated matches [226842] (3 species)
    not a true protein
  7. 1406914Species Mouse (Mus musculus) [TaxId:10090] [224924] (24 PDB entries)
  8. 1406940Domain d3rzca1: 3rzc A:6-185 [200569]
    Other proteins in same PDB: d3rzca2, d3rzcb_, d3rzcc1, d3rzcc2, d3rzcd1, d3rzcd2
    automated match to d1onqa2
    complexed with lgn

Details for d3rzca1

PDB Entry: 3rzc (more details), 2.8 Å

PDB Description: Structure of the self-antigen iGb3 bound to mouse CD1d and in complex with the iNKT TCR
PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3rzca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rzca1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

SCOPe Domain Coordinates for d3rzca1:

Click to download the PDB-style file with coordinates for d3rzca1.
(The format of our PDB-style files is described here.)

Timeline for d3rzca1: