SCOP 1.73: Domain d1nmcl_: 1nmc L:

Lineage for d1nmcl_ (1nmc L:)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (181 PDB entries)

8. Domain d1nmcl_: 1nmc L: [20056]
   Other proteins in same PDB: d1nmca_, d1nmcb_, d1nmch_, d1nmcn_

Details for d1nmcl_

PDB Entry: 1nmc, 2.5 Å

PDB Description: complex between nc10 anti-influenza virus neuraminidase single chain antibody with a 15 residue linker and influenza virus neuraminidase

PDB Compounds: (L:) single chain antibody

SCOP Domain Sequences for d1nmcl_:

Sequence; same for both SEQRES and ATOM records:

>d1nmcl_ b.1.1.1 (L:) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4 [TaxId: 10090]}
dieltqttsslsaslgdrvtiscrasqdisnylnwyqqnpdgtvklliyytsnlhsevps
rfsgsgsgtdysltisnleqediatyfcqqdftlpftfgggtkleirdy

Timeline for d1nmcl_:

• d1nmcl_ first appeared (with stable ids) in SCOP 1.55
  
• d1nmcl_ appears in SCOP 1.71
  
• d1nmcl_ appears in SCOP 1.75
  
• d1nmcl_ appears in the current release, SCOPe 2.08