Lineage for d3rugg1 (3rug G:3-129)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2365354Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2365355Protein automated matches [190740] (29 species)
    not a true protein
  7. 2369776Species Mouse (Mus musculus) [TaxId:10090] [188198] (822 PDB entries)
  8. 2370074Domain d3rugg1: 3rug G:3-129 [200531]
    Other proteins in same PDB: d3ruga1, d3ruga2, d3ruga3, d3rugb_, d3rugc1, d3rugc2, d3rugc3, d3rugd_, d3ruge2, d3rugf2, d3rugg2, d3rugh2
    automated match to d1qrnd1
    complexed with db6, nag

Details for d3rugg1

PDB Entry: 3rug (more details), 2.2 Å

PDB Description: crystal structure of valpha10-vbeta8.1 nkt tcr in complex with cd1d- alphaglucosylceramide (c20:2)
PDB Compounds: (G:) Valpha10(mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3rugg1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3rugg1 b.1.1.0 (G:3-129) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qveqspaslvlqegenaelqctysttlnsmqwfyqrpggrlvsllyspswaeqrggrlts
saasnesrsslhisssqitdsgtylcaiasssfsklvfgqgtslsvvpn

SCOPe Domain Coordinates for d3rugg1:

Click to download the PDB-style file with coordinates for d3rugg1.
(The format of our PDB-style files is described here.)

Timeline for d3rugg1: