Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
Domain d3rugf2: 3rug F:129-256 [200530] Other proteins in same PDB: d3ruga1, d3ruga3, d3rugb_, d3rugc1, d3rugc3, d3rugd_, d3ruge1, d3rugf1, d3rugg1, d3rugh1 automated match to d1ktke2 complexed with db6, nag |
PDB Entry: 3rug (more details), 2.2 Å
SCOPe Domain Sequences for d3rugf2:
Sequence, based on SEQRES records: (download)
>d3rugf2 b.1.1.2 (F:129-256) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv saeawgra
>d3rugf2 b.1.1.2 (F:129-256) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq plkeqpalsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivsa eawgra
Timeline for d3rugf2: