SCOP 1.73: Domain d1mlcb1: 1mlc B:1-118

Lineage for d1mlcb1 (1mlc B:1-118)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)

8. Domain d1mlcb1: 1mlc B:1-118 [20053]
   Other proteins in same PDB: d1mlca1, d1mlca2, d1mlcb2, d1mlcc1, d1mlcc2, d1mlcd2, d1mlce_, d1mlcf_

Details for d1mlcb1

PDB Entry: 1mlc, 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme complexed with lysozyme

PDB Compounds: (B:) igg1-kappa d44.1 fab (heavy chain)

SCOP Domain Sequences for d1mlcb1:

Sequence; same for both SEQRES and ATOM records:

>d1mlcb1 b.1.1.1 (B:1-118) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2 [TaxId: 10090]}
qvqlqesgaevmkpgasvkisckatgytfstywiewvkqrpghglewigeilpgsgstyy
nekfkgkatftadtssntaymqlssltsedsavyycargdgnygywgqgttltvssas

Timeline for d1mlcb1:

• d1mlcb1 first appeared (with stable ids) in SCOP 1.55
  
• d1mlcb1 appears in SCOP 1.71
  
• d1mlcb1 appears in SCOP 1.75
  
• d1mlcb1 appears in the current release, SCOPe 2.08