SCOPe 2.04: Domain d3ruga2: 3rug A:186-296

Lineage for d3ruga2 (3rug A:186-296)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (9 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries)

8. Domain d3ruga2: 3rug A:186-296 [200523]
   Other proteins in same PDB: d3ruga1, d3rugb_, d3rugc1, d3rugd_, d3ruge1, d3rugf1, d3rugg1, d3rugh1
   automated match to d1gzqa1
   complexed with db6, nag

Details for d3ruga2

PDB Entry: 3rug, 2.2 Å

PDB Description: crystal structure of valpha10-vbeta8.1 nkt tcr in complex with cd1d- alphaglucosylceramide (c20:2)

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3ruga2:

Sequence, based on SEQRES records:

>d3ruga2 b.1.1.2 (A:186-296) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpssahghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw
ylqatldveageeaglacrvkhsslggqdiilywgslhhildaqkmvwnhr

Sequence, based on observed residues (ATOM records):

>d3ruga2 b.1.1.2 (A:186-296) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
qekpvawlssvpsghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylq
atldveageeaglacrvkhsslggqdiilywgslhhildaqkmvwnhr

Timeline for d3ruga2:

• d3ruga2 first appeared in SCOPe 2.03
  
• d3ruga2 appears in SCOPe 2.05
  
• d3ruga2 appears in the current release, SCOPe 2.08