Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Mouse (Mus musculus) [TaxId:10090] [226194] (2 PDB entries) |
Domain d3rtqc2: 3rtq C:118-206 [200519] Other proteins in same PDB: d3rtqa1, d3rtqa2, d3rtqb_, d3rtqc1, d3rtqd1, d3rtqd2 automated match to d1qrnd2 complexed with h4s, nag |
PDB Entry: 3rtq (more details), 2.8 Å
SCOPe Domain Sequences for d3rtqc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rtqc2 b.1.1.2 (C:118-206) T-cell antigen receptor {Mouse (Mus musculus) [TaxId: 10090]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d3rtqc2: