![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (9 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (343 PDB entries) |
![]() | Domain d3rtqa2: 3rtq A:186-279 [200517] Other proteins in same PDB: d3rtqa1, d3rtqb_, d3rtqc1, d3rtqc2, d3rtqd1, d3rtqd2 automated match to d1onqa1 complexed with h4s, nag |
PDB Entry: 3rtq (more details), 2.8 Å
SCOPe Domain Sequences for d3rtqa2:
Sequence, based on SEQRES records: (download)
>d3rtqa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpssadghrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetw ylqatldveageeaglacrvkhsslggqdiilyw
>d3rtqa2 b.1.1.2 (A:186-279) automated matches {Mouse (Mus musculus) [TaxId: 10090]} qekpvawlssvpsrqlvchvsgfypkpvwvmwmrgdqeqqgthrgdflpnadetwylqat ldveageeaglacrvkhsslggqdiilyw
Timeline for d3rtqa2: