![]() | Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
![]() | Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
![]() | Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) ![]() |
![]() | Family d.19.1.0: automated matches [227140] (1 protein) not a true family |
![]() | Protein automated matches [226842] (3 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224924] (24 PDB entries) |
![]() | Domain d3rtqa1: 3rtq A:7-185 [200516] Other proteins in same PDB: d3rtqa2, d3rtqb_, d3rtqc1, d3rtqc2, d3rtqd1, d3rtqd2 automated match to d1onqa2 complexed with h4s, nag |
PDB Entry: 3rtq (more details), 2.8 Å
SCOPe Domain Sequences for d3rtqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rtqa1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]} nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3rtqa1: