Lineage for d1mlbb1 (1mlb B:1-118)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 6995Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
  6. 7065Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
  7. 7645Species Fab D44.1 (mouse), kappa L chain [48803] (2 PDB entries)
  8. 7647Domain d1mlbb1: 1mlb B:1-118 [20051]
    Other proteins in same PDB: d1mlba2, d1mlbb2

Details for d1mlbb1

PDB Entry: 1mlb (more details), 2.1 Å

PDB Description: monoclonal antibody fab d44.1 raised against chicken egg-white lysozyme

SCOP Domain Sequences for d1mlbb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mlbb1 b.1.1.1 (B:1-118) Immunoglobulin (variable domains of L and H chains) {Fab D44.1 (mouse), kappa L chain}
qvqlqesgaevmkpgasvkisckatgytfstywiewvkqrpghglewigeilpgsgstyy
nekfkgkatftadtssntaymqlssltsedsavyycargdgnygywgqgttltvssas

SCOP Domain Coordinates for d1mlbb1:

Click to download the PDB-style file with coordinates for d1mlbb1.
(The format of our PDB-style files is described here.)

Timeline for d1mlbb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mlbb2