Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) division into families based on beta-sheet topologies |
Family c.37.1.0: automated matches [191323] (1 protein) not a true family |
Protein automated matches [190123] (130 species) not a true protein |
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225477] (12 PDB entries) |
Domain d3rrma1: 3rrm A:98-286 [200504] Other proteins in same PDB: d3rrmc1, d3rrmc2 automated match to d1xtia1 complexed with adp, ihp, mg |
PDB Entry: 3rrm (more details), 2.9 Å
SCOPe Domain Sequences for d3rrma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3rrma1 c.37.1.0 (A:98-286) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} glapellkgiyamkfqkpskiqeralplllhnpprnmiaqsqsgtgktaafsltmltrvn pedaspqaiclapsrelarqtlevvqemgkftkitsqlivpdsfeknkqinaqvivgtpg tvldlmrrklmqlqkikifvldeadnmldqqglgdqcirvkrflpkdtqlvlfsatfada vrqyakkiv
Timeline for d3rrma1: