SCOPe 2.02: Domain d1ibgh1: 1ibg H:2-113

Lineage for d1ibgh1 (1ibg H:2-113)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)

8. Domain d1ibgh1: 1ibg H:2-113 [20049]
   Other proteins in same PDB: d1ibgh2, d1ibgl1, d1ibgl2
   part of Fab 40-50
   complexed with cu, obn

Details for d1ibgh1

PDB Entry: 1ibg, 2.7 Å

PDB Description: structure and specificity of the anti-digoxin antibody 40-50

PDB Compounds: (H:) igg2b-kappa 40-50 fab (heavy chain)

SCOPe Domain Sequences for d1ibgh1:

Sequence; same for both SEQRES and ATOM records:

>d1ibgh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
vhlvqsgpglvapsqslsitctvsgfslttygvhwfrqppgkglewlgliwaggntdyns
almsrlsinkdnsksqvflkmnslqaddtamyycarfrfasyydyavdywgqgtsvtvss

Timeline for d1ibgh1:

• d1ibgh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ibgh1 appears in SCOPe 2.01
  
• d1ibgh1 appears in SCOPe 2.03
  
• d1ibgh1 appears in the current release, SCOPe 2.08