Lineage for d1ibgh1 (1ibg H:2-113)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652810Species Mouse (Mus musculus), cluster 5 [TaxId:10090] [88555] (36 PDB entries)
  8. 652849Domain d1ibgh1: 1ibg H:2-113 [20049]
    Other proteins in same PDB: d1ibgh2, d1ibgl1, d1ibgl2
    part of Fab 40-50
    complexed with cu, obn

Details for d1ibgh1

PDB Entry: 1ibg (more details), 2.7 Å

PDB Description: structure and specificity of the anti-digoxin antibody 40-50
PDB Compounds: (H:) igg2b-kappa 40-50 fab (heavy chain)

SCOP Domain Sequences for d1ibgh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ibgh1 b.1.1.1 (H:2-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 5 [TaxId: 10090]}
vhlvqsgpglvapsqslsitctvsgfslttygvhwfrqppgkglewlgliwaggntdyns
almsrlsinkdnsksqvflkmnslqaddtamyycarfrfasyydyavdywgqgtsvtvss

SCOP Domain Coordinates for d1ibgh1:

Click to download the PDB-style file with coordinates for d1ibgh1.
(The format of our PDB-style files is described here.)

Timeline for d1ibgh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ibgh2