SCOP 1.57: Domain d1ibgh1: 1ibg H:2-113

Lineage for d1ibgh1 (1ibg H:2-113)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (14 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (195 species)

7. Species Fab 40-50 (mouse), kappa L chain [48802] (1 PDB entry)

8. Domain d1ibgh1: 1ibg H:2-113 [20049]
   Other proteins in same PDB: d1ibgh2, d1ibgl2

Details for d1ibgh1

PDB Entry: 1ibg, 2.7 Å

PDB Description: structure and specificity of the anti-digoxin antibody 40-50

SCOP Domain Sequences for d1ibgh1:

Sequence; same for both SEQRES and ATOM records:

>d1ibgh1 b.1.1.1 (H:2-113) Immunoglobulin (variable domains of L and H chains) {Fab 40-50 (mouse), kappa L chain}
vhlvqsgpglvapsqslsitctvsgfslttygvhwfrqppgkglewlgliwaggntdyns
almsrlsinkdnsksqvflkmnslqaddtamyycarfrfasyydyavdywgqgtsvtvss

Timeline for d1ibgh1:

• d1ibgh1 first appeared (with stable ids) in SCOP 1.55
  
• d1ibgh1 appears in SCOP 1.59
  
• d1ibgh1 appears in the current release, SCOPe 2.08