SCOPe 2.05: Domain d3rgvb2: 3rgv B:113-236

Lineage for d3rgvb2 (3rgv B:113-236)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (368 PDB entries)

8. Domain d3rgvb2: 3rgv B:113-236 [200474]
   Other proteins in same PDB: d3rgva1, d3rgvb1, d3rgvc1, d3rgvc2, d3rgvd_
   automated match to d1qsee2

Details for d3rgvb2

PDB Entry: 3rgv, 2.9 Å

PDB Description: A single TCR bound to MHCI and MHC II reveals switchable TCR conformers

PDB Compounds: (B:) Yae62 TCR b chain

SCOPe Domain Sequences for d3rgvb2:

Sequence; same for both SEQRES and ATOM records:

>d3rgvb2 b.1.1.2 (B:113-236) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpqp
lkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqivs
aeaw

Timeline for d3rgvb2:

• d3rgvb2 first appeared in SCOPe 2.03
  
• d3rgvb2 appears in SCOPe 2.04
  
• d3rgvb2 appears in SCOPe 2.06
  
• d3rgvb2 appears in the current release, SCOPe 2.08