SCOP 1.65: Domain d1igcl1: 1igc L:1-108

Lineage for d1igcl1 (1igc L:1-108)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (21 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogeneous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 4 [TaxId:10090] [88531] (146 PDB entries)

8. Domain d1igcl1: 1igc L:1-108 [20046]
   Other proteins in same PDB: d1igca_, d1igch1, d1igch2, d1igcl2
   part of Fab MoPC21

Details for d1igcl1

PDB Entry: 1igc, 2.6 Å

PDB Description: igg1 fab fragment (mopc21) complex with domain iii of protein g from streptococcus

SCOP Domain Sequences for d1igcl1:

Sequence; same for both SEQRES and ATOM records:

>d1igcl1 b.1.1.1 (L:1-108) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 4}
nivmtqspksmsmsvgervtltckasenvvtyvswyqqkpeqspklliygasnrytgvpd
rftgsgsatdftltissvqaedladyhcgqgnsypytfgggtkleikr

Timeline for d1igcl1:

• d1igcl1 first appeared (with stable ids) in SCOP 1.55
  
• d1igcl1 appears in SCOP 1.63
  
• d1igcl1 appears in SCOP 1.67
  
• d1igcl1 appears in the current release, SCOPe 2.08