Lineage for d1nqbc1 (1nqb C:2-120)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220215Species scFv trivalent antibody, based on: (mouse), kappa L chain [48800] (1 PDB entry)
    VH domain is from B1-8 antibody (1A6U CH H) and is N-terminal; VL domain is from NQ11 antibody and is C-terminal
  8. 220218Domain d1nqbc1: 1nqb C:2-120 [20044]

Details for d1nqbc1

PDB Entry: 1nqb (more details), 2 Å

PDB Description: trivalent antibody fragment

SCOP Domain Sequences for d1nqbc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nqbc1 b.1.1.1 (C:2-120) Immunoglobulin (variable domains of L and H chains) {scFv trivalent antibody, based on: (mouse), kappa L chain}
vqlqqsgaelvkpgasvklsckasgytftsywmhwvkqrpgrglewigridpnsggtkyn
ekfkskatltvdkpsstaymqlssltsedsavyycarydyygssyfdywgqgttvtvss

SCOP Domain Coordinates for d1nqbc1:

Click to download the PDB-style file with coordinates for d1nqbc1.
(The format of our PDB-style files is described here.)

Timeline for d1nqbc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nqbc2