Lineage for d3r8bc2 (3r8b C:122-237)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1637451Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1639209Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1639210Family d.15.6.1: Superantigen toxins, C-terminal domain [54335] (16 proteins)
  6. 1639232Protein Staphylococcal enterotoxin B, SEB [54342] (1 species)
  7. 1639233Species Staphylococcus aureus [TaxId:1280] [54343] (14 PDB entries)
  8. 1639250Domain d3r8bc2: 3r8b C:122-237 [200434]
    Other proteins in same PDB: d3r8ba1, d3r8bb_, d3r8bc1, d3r8bd_, d3r8be1, d3r8bf_, d3r8bg1, d3r8bh_, d3r8bi1, d3r8bj_, d3r8bk1, d3r8bl_, d3r8bm1, d3r8bn_, d3r8bo1, d3r8bp_
    automated match to d1d5mc2
    complexed with cl, so4, zn

Details for d3r8bc2

PDB Entry: 3r8b (more details), 2.95 Å

PDB Description: Crystal structure of Staphylococcal Enterotoxin B in complex with an affinity matured mouse TCR VBeta8.2 protein, G5-8
PDB Compounds: (C:) enterotoxin type b

SCOPe Domain Sequences for d3r8bc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r8bc2 d.15.6.1 (C:122-237) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
ngnqldkyrsitvrvfedgknllsfdvqtnkkkvtaqeldyltrhylvknkklyefnnsp
yetgyikfienensfwydmmpapgdkfdqskylmmyndnkmvdskdvkievylttk

SCOPe Domain Coordinates for d3r8bc2:

Click to download the PDB-style file with coordinates for d3r8bc2.
(The format of our PDB-style files is described here.)

Timeline for d3r8bc2: