Lineage for d3r8ba1 (3r8b A:2-121)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2058419Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 2059068Family b.40.2.2: Superantigen toxins, N-terminal domain [50219] (16 proteins)
  6. 2059090Protein Staphylococcal enterotoxin B, SEB [50226] (1 species)
  7. 2059091Species Staphylococcus aureus [TaxId:1280] [50227] (18 PDB entries)
  8. 2059108Domain d3r8ba1: 3r8b A:2-121 [200431]
    Other proteins in same PDB: d3r8ba2, d3r8bb_, d3r8bc2, d3r8bd_, d3r8be2, d3r8bf_, d3r8bg2, d3r8bh_, d3r8bi2, d3r8bj_, d3r8bk2, d3r8bl_, d3r8bm2, d3r8bn_, d3r8bo2, d3r8bp_
    automated match to d1d5mc1
    complexed with cl, so4, zn

Details for d3r8ba1

PDB Entry: 3r8b (more details), 2.95 Å

PDB Description: Crystal structure of Staphylococcal Enterotoxin B in complex with an affinity matured mouse TCR VBeta8.2 protein, G5-8
PDB Compounds: (A:) enterotoxin type b

SCOPe Domain Sequences for d3r8ba1:

Sequence, based on SEQRES records: (download)

>d3r8ba1 b.40.2.2 (A:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskktndinshqtdkrktcmyggvteh

Sequence, based on observed residues (ATOM records): (download)

>d3r8ba1 b.40.2.2 (A:2-121) Staphylococcal enterotoxin B, SEB {Staphylococcus aureus [TaxId: 1280]}
sqpdpkpdelhksskftglmenmkvlyddnhvsainvksidqflyfdliysikdtklgny
dnvrvefknkdladkykdkyvdvfganyyyqcyfskrktcmyggvteh

SCOPe Domain Coordinates for d3r8ba1:

Click to download the PDB-style file with coordinates for d3r8ba1.
(The format of our PDB-style files is described here.)

Timeline for d3r8ba1: