SCOP 1.55: Domain d1nqba2: 1nqb A:121-233

Lineage for d1nqba2 (1nqb A:121-233)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)

6. Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)

7. Species scFv trivalent antibody, based on: (mouse), kappa L chain [48800] (1 PDB entry)

8. Domain d1nqba2: 1nqb A:121-233 [20043]

Details for d1nqba2

PDB Entry: 1nqb, 2 Å

PDB Description: trivalent antibody fragment

SCOP Domain Sequences for d1nqba2:

Sequence; same for both SEQRES and ATOM records:

>d1nqba2 b.1.1.1 (A:121-233) Immunoglobulin (variable domains of L and H chains) {scFv trivalent antibody, based on: (mouse), kappa L chain}
dieltqtplslpvslgdqasiscrssqsivhsngntylewylqkpgqspklliykvsnrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyycfqgshvpytfgggtkleikr

Timeline for d1nqba2:

• d1nqba2 appears in SCOP 1.57
  
• d1nqba2 appears in the current release, SCOPe 2.08