Lineage for d3qz5a_ (3qz5 A:)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2224127Fold d.149: Nitrile hydratase alpha chain [56208] (1 superfamily)
    4 layers a/b/b/a; inside is a sandwich of two 2-stranded beta-sheets
  4. 2224128Superfamily d.149.1: Nitrile hydratase alpha chain [56209] (2 families) (S)
    duplication: contains two structural repeats
  5. 2224129Family d.149.1.1: Nitrile hydratase alpha chain [56210] (3 proteins)
    automatically mapped to Pfam PF02979
  6. 2224149Protein automated matches [190256] (6 species)
    not a true protein
  7. 2224156Species Pseudomonas putida [TaxId:303] [226093] (5 PDB entries)
  8. 2224173Domain d3qz5a_: 3qz5 A: [200423]
    Other proteins in same PDB: d3qz5b_, d3qz5d_, d3qz5f_, d3qz5h_
    automated match to d2dppa_
    complexed with 3co, gol

Details for d3qz5a_

PDB Entry: 3qz5 (more details), 2.5 Å

PDB Description: crystal structure of co-type nitrile hydratase alpha-e168q from pseudomonas putida.
PDB Compounds: (A:) Co-type Nitrile Hydratase alpha subunit

SCOPe Domain Sequences for d3qz5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qz5a_ d.149.1.1 (A:) automated matches {Pseudomonas putida [TaxId: 303]}
hdhhhdgyqappedialrvkaleslliekglvdpaamdlvvqtyehkvgprngakvvaka
wvdpaykarlladgtagiaelgfsgvqgedmvilentpavhnvfvctlcscypwptlglp
pawykaapyrsrmvsdprgvlaefglvipankeirvwdttaqlrymvlperpagteayse
eqlaelvtrdsmigtglptqp

SCOPe Domain Coordinates for d3qz5a_:

Click to download the PDB-style file with coordinates for d3qz5a_.
(The format of our PDB-style files is described here.)

Timeline for d3qz5a_: