Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries) |
Domain d3qwol2: 3qwo L:108-211 [200420] Other proteins in same PDB: d3qwob1, d3qwoc_, d3qwol1, d3qwop_ automated match to d1rhha2 complexed with edo, so4 |
PDB Entry: 3qwo (more details), 1.9 Å
SCOPe Domain Sequences for d3qwol2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qwol2 b.1.1.2 (L:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} rtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteqd skdstyslsstltlskadyekhkvyacevthqglsspvtksfnr
Timeline for d3qwol2:
View in 3D Domains from other chains: (mouse over for more information) d3qwob1, d3qwob2, d3qwoc_, d3qwop_ |