Lineage for d3quyd2 (3quy D:113-240)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1755447Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1764871Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 1764872Protein automated matches [190740] (26 species)
    not a true protein
  7. 1766572Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)
  8. 1766788Domain d3quyd2: 3quy D:113-240 [200403]
    Other proteins in same PDB: d3quya1, d3quya2, d3quyb_, d3quyc2, d3quyd1
    automated match to d1lp9f2
    complexed with gol, nag, quy

Details for d3quyd2

PDB Entry: 3quy (more details), 2.25 Å

PDB Description: structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex
PDB Compounds: (D:) Vbeta8.2 (mouse variable domain, human constant domain)

SCOPe Domain Sequences for d3quyd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3quyd2 b.1.1.0 (D:113-240) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dlrnvtppkvslfepskaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryslssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgra

SCOPe Domain Coordinates for d3quyd2:

Click to download the PDB-style file with coordinates for d3quyd2.
(The format of our PDB-style files is described here.)

Timeline for d3quyd2: