SCOP 1.69: Domain d1lmkg1: 1lmk G:2-127

Lineage for d1lmkg1 (1lmk G:2-127)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (27 proteins)

6. Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
   VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (143 PDB entries)

8. Domain d1lmkg1: 1lmk G:2-127 [20040]
   Other proteins in same PDB: d1lmka2, d1lmkc2, d1lmke2, d1lmkg2
   part of scFv diabody L5MK16

Details for d1lmkg1

PDB Entry: 1lmk, 2.6 Å

PDB Description: the structure of a bivalent diabody

SCOP Domain Sequences for d1lmkg1:

Sequence; same for both SEQRES and ATOM records:

>d1lmkg1 b.1.1.1 (G:2-127) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
vqlqqsgtelmkpgrslkisckttgyifsnywiewvkqrpghglewigkilpgggsntyn
dkfkgkatftadtssniaymqlssltsedsavyycargedyyaywyvldywgqgttvtvs
sggggs

Timeline for d1lmkg1:

• d1lmkg1 first appeared (with stable ids) in SCOP 1.55
  
• d1lmkg1 appears in SCOP 1.67
  
• d1lmkg1 appears in SCOP 1.71
  
• d1lmkg1 appears in the current release, SCOPe 2.08