SCOPe 2.06: Domain d3quya1: 3quy A:6-185

Lineage for d3quya1 (3quy A:6-185)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (4 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (33 PDB entries)

8. Domain d3quya1: 3quy A:6-185 [200398]
   Other proteins in same PDB: d3quya2, d3quyb_, d3quyc1, d3quyc2, d3quyd1, d3quyd2
   automated match to d1onqa2
   complexed with gol, nag, quy

Details for d3quya1

PDB Entry: 3quy, 2.25 Å

PDB Description: structure of the mouse cd1d-bnnh-gsl-1'-inkt tcr complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3quya1:

Sequence; same for both SEQRES and ATOM records:

>d3quya1 d.19.1.0 (A:6-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek
lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv
vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d3quya1:

• d3quya1 first appeared in SCOPe 2.03
  
• d3quya1 appears in SCOPe 2.05
  
• d3quya1 appears in SCOPe 2.07
  
• d3quya1 appears in the current release, SCOPe 2.08