SCOPe 2.03: Domain d3quxa1: 3qux A:7-185

Lineage for d3quxa1 (3qux A:7-185)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (3 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224924] (24 PDB entries)

8. Domain d3quxa1: 3qux A:7-185 [200392]
   Other proteins in same PDB: d3quxa2, d3quxb_, d3quxc1, d3quxc2, d3quxd1, d3quxd2
   automated match to d1onqa2
   complexed with nag, qux

Details for d3quxa1

PDB Entry: 3qux, 2.91 Å

PDB Description: structure of the mouse cd1d-alpha-c-galcer-inkt tcr complex

PDB Compounds: (A:) Antigen-presenting glycoprotein CD1d1

SCOPe Domain Sequences for d3quxa1:

Sequence; same for both SEQRES and ATOM records:

>d3quxa1 d.19.1.0 (A:7-185) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
nytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwekl
qhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyvv
rfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek

Timeline for d3quxa1:

• d3quxa1 is new in SCOPe 2.03-stable
  
• d3quxa1 appears in SCOPe 2.04
  
• d3quxa1 appears in the current release, SCOPe 2.08