SCOP 1.55: Domain d1lmke2: 1lmk E:201-312

Lineage for d1lmke2 (1lmk E:201-312)

Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (12 proteins)
Protein Immunoglobulin (variable domains of L and H chains) [48749] (183 species)
Species scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain [48799] (1 PDB entry)
Domain d1lmke2: 1lmk E:201-312 [20039]

Details for d1lmke2

PDB Entry: 1lmk (more details), 2.6 Å

PDB Description: the structure of a bivalent diabody

SCOP Domain Sequences for d1lmke2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmke2 b.1.1.1 (E:201-312) Immunoglobulin (variable domains of L and H chains) {scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain}
dieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliykvstrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk

SCOP Domain Coordinates for d1lmke2:

Click to download the PDB-style file with coordinates for d1lmke2.
(The format of our PDB-style files is described here.)

Timeline for d1lmke2: