Lineage for d1lmkc2 (1lmk C:201-312)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 218899Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (15 proteins)
  6. 218958Protein Immunoglobulin (variable domains of L and H chains) [48749] (228 species)
  7. 220203Species scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain [48799] (1 PDB entry)
  8. 220207Domain d1lmkc2: 1lmk C:201-312 [20037]

Details for d1lmkc2

PDB Entry: 1lmk (more details), 2.6 Å

PDB Description: the structure of a bivalent diabody

SCOP Domain Sequences for d1lmkc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lmkc2 b.1.1.1 (C:201-312) Immunoglobulin (variable domains of L and H chains) {scFv dimer (L5MK16 diabody), based on: (mouse), kappa L chain}
dieltqsplslpvslgdqasiscrssqslvhsngntslhwylkkpgqspklliykvstrf
sgvpdrfsgsgsgtdftlkisrveaedlgvyfcsqsthvpftfgsgtklelk

SCOP Domain Coordinates for d1lmkc2:

Click to download the PDB-style file with coordinates for d1lmkc2.
(The format of our PDB-style files is described here.)

Timeline for d1lmkc2: