SCOPe 2.05: Domain d3qi9c1: 3qi9 C:1-117

Lineage for d3qi9c1 (3qi9 C:1-117)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (26 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (413 PDB entries)

8. Domain d3qi9c1: 3qi9 C:1-117 [200348]
   Other proteins in same PDB: d3qi9a1, d3qi9a2, d3qi9b_, d3qi9c2, d3qi9d2
   automated match to d1qrnd1
   complexed with gol, mg, nag, pii

Details for d3qi9c1

PDB Entry: 3qi9, 2.3 Å

PDB Description: crystal structure of mouse cd1d-alpha-phosphotidylinositol with mouse valpha14-vbeta6 2a3-d nkt tcr

PDB Compounds: (C:) NKT TCR V alpha 14

SCOPe Domain Sequences for d3qi9c1:

Sequence; same for both SEQRES and ATOM records:

>d3qi9c1 b.1.1.0 (C:1-117) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
tqveqspqslvvrqgensvlqcnysvtpdnhlrwfkqdtgkglvsltvlvdqkdktsngr
ysatldkdakhstlhitatllddtatyicvvgdrgsalgrlhfgagtqlivipd

Timeline for d3qi9c1:

• d3qi9c1 first appeared in SCOPe 2.03
  
• d3qi9c1 appears in SCOPe 2.04
  
• d3qi9c1 appears in SCOPe 2.06
  
• d3qi9c1 appears in the current release, SCOPe 2.08