Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily) dimeric |
Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) |
Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins) |
Protein CD1, alpha-1 and alpha-2 domains [54456] (5 species) Class I MHC-related |
Species Mouse (Mus musculus) [TaxId:10090] [54457] (25 PDB entries) |
Domain d3qi9a1: 3qi9 A:6-185 [200346] Other proteins in same PDB: d3qi9a2, d3qi9b_, d3qi9c1, d3qi9c2, d3qi9d1, d3qi9d2 automated match to d1gzpa2 complexed with gol, mg, nag, pii |
PDB Entry: 3qi9 (more details), 2.3 Å
SCOPe Domain Sequences for d3qi9a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qi9a1 d.19.1.1 (A:6-185) CD1, alpha-1 and alpha-2 domains {Mouse (Mus musculus) [TaxId: 10090]} knytfrclqmssfanrswsrtdsvvwlgdlqthrwsndsatisftkpwsqgklsnqqwek lqhmfqvyrvsftrdiqelvkmmspkedypieiqlsagcemypgnasesflhvafqgkyv vrfwgtswqtvpgapswldlpikvlnadqgtsatvqmllndtcplfvrglleagksdlek
Timeline for d3qi9a1: