Class b: All beta proteins [48724] (177 folds) |
Fold b.69: 7-bladed beta-propeller [50964] (15 superfamilies) consists of seven 4-stranded beta-sheet motifs; meander |
Superfamily b.69.5: RCC1/BLIP-II [50985] (2 families) two families are clearly related but differ by the number of strands per blade |
Family b.69.5.2: beta-lactamase inhibitor protein-II, BLIP-II [69315] (2 proteins) lacks the outer strands |
Protein automated matches [193685] (1 species) not a true protein |
Species Streptomyces exfoliatus [TaxId:1905] [193686] (2 PDB entries) |
Domain d3qhyb_: 3qhy B: [200341] Other proteins in same PDB: d3qhya_ automated match to d3qi0c_ |
PDB Entry: 3qhy (more details), 2.06 Å
SCOPe Domain Sequences for d3qhyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3qhyb_ b.69.5.2 (B:) automated matches {Streptomyces exfoliatus [TaxId: 1905]} atsvvawggnndwgeatvpaeaqsgvdaiaggyfhglalkggkvlgwganlngqltmpaa tqsgvdaiaagnyhslalkdgeviawggnedgqttvpaearsgvdaiaagawasyalkdg kviawgddsdgqttvpaeaqsgvtaldggvytalavknggviawgdnyfgqttvpaeaqs gvddvaggifhslalkdgkviawgdnrykqttvptealsgvsaiasgewyslalkngkvi awgssrtapssvqsgvssieagpnaayalkg
Timeline for d3qhyb_: