SCOPe 2.06: Domain d3qfjd2: 3qfj D:118-206

Lineage for d3qfjd2 (3qfj D:118-206)

Root: SCOPe 2.06
Class b: All beta proteins [48724] (177 folds)
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
sandwich; 7 strands in 2 sheets; greek-key
some members of the fold have additional strands
Superfamily b.1.1: Immunoglobulin [48726] (5 families)
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
Protein T-cell antigen receptor [49125] (7 species)
Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (24 PDB entries)
Domain d3qfjd2: 3qfj D:118-206 [200336]
Other proteins in same PDB: d3qfja1, d3qfja2, d3qfjb1, d3qfjb2, d3qfjd1, d3qfje1, d3qfje2
automated match to d1qsed2
complexed with gol

Details for d3qfjd2

PDB Entry: 3qfj (more details), 2.29 Å

PDB Description: The complex between TCR A6 and human Class I MHC HLA-A2 with the modified TAX (Y5F) peptide

PDB Compounds: (D:) A6 alpha chain

SCOPe Domain Sequences for d3qfjd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3qfjd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3qfjd2:

Click to download the PDB-style file with coordinates for d3qfjd2.
(The format of our PDB-style files is described here.)

Timeline for d3qfjd2: