Lineage for d1ikfh1 (1ikf H:1-126)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 651989Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (29 proteins)
  6. 652160Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 652445Species Mouse (Mus musculus), cluster 2.2 [TaxId:10090] [88550] (51 PDB entries)
  8. 652464Domain d1ikfh1: 1ikf H:1-126 [20033]
    Other proteins in same PDB: d1ikfh2, d1ikfl1, d1ikfl2
    part of an anti-cyclosporin A Fab
    complexed with aba

Details for d1ikfh1

PDB Entry: 1ikf (more details), 2.5 Å

PDB Description: a conformation of cyclosporin a in aqueous environment revealed by the x-ray structure of a cyclosporin-fab complex
PDB Compounds: (H:) igg1-kappa r45-45-11 fab (heavy chain)

SCOP Domain Sequences for d1ikfh1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ikfh1 b.1.1.1 (H:1-126) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 2.2 [TaxId: 10090]}
evklvesggglvqpggslklscatsgftfsdyymywvrqnsekrlewvafisngggsafy
adivkgrftisrdnakntlylqmsrlksedtamyyctrhtlydtlygnypvwfadwgqgt
lvtvsa

SCOP Domain Coordinates for d1ikfh1:

Click to download the PDB-style file with coordinates for d1ikfh1.
(The format of our PDB-style files is described here.)

Timeline for d1ikfh1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ikfh2