SCOPe 2.05: Domain d3qeqd2: 3qeq D:110-195

Lineage for d3qeqd2 (3qeq D:110-195)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries)

8. Domain d3qeqd2: 3qeq D:110-195 [200324]
   Other proteins in same PDB: d3qeqa1, d3qeqa2, d3qeqb_, d3qeqd1, d3qeqe1, d3qeqe2
   automated match to d1qrnd2

Details for d3qeqd2

PDB Entry: 3qeq, 2.59 Å

PDB Description: the complex between tcr dmf4 and human class i mhc hla-a2 with the bound mart-1(27-35) nonameric peptide

PDB Compounds: (D:) DMF4 alpha chain

SCOPe Domain Sequences for d3qeqd2:

Sequence; same for both SEQRES and ATOM records:

>d3qeqd2 b.1.1.2 (D:110-195) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Timeline for d3qeqd2:

• d3qeqd2 first appeared in SCOPe 2.03
  
• d3qeqd2 appears in SCOPe 2.04
  
• d3qeqd2 appears in SCOPe 2.06
  
• d3qeqd2 appears in the current release, SCOPe 2.08